PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_58615_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 215aa    MW: 24558.2 Da    PI: 7.0537
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_58615_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.64.9e-091581902355
                                          SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                             Homeobox  23 rypsaeereeLAkklgLterqVkvWFqNrRake 55 
                                          +yp++ee+  LA+ +gL++rq+ +WF N+R ++
  cra_locus_58615_iso_1_len_693_ver_3 158 PYPTEEEKNVLAEVTGLDQRQINNWFINQRKRH 190
                                          8*****************************885 PP

2ELK30.96e-11111131222
                                  ELK   2 LKhqLlrKYsgyLgsLkqEFs 22 
                                          LK++L++KY+gyL++Lk+ F+
  cra_locus_58615_iso_1_len_693_ver_3 111 LKEMLMKKYGGYLSGLKSDFL 131
                                          9******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.5E-15143IPR005540KNOX1
PfamPF037906.5E-18240IPR005540KNOX1
PROSITE profilePS512139.359110130IPR005539ELK domain
SMARTSM011881.3E-4110131IPR005539ELK domain
PfamPF037891.7E-7111131IPR005539ELK domain
PROSITE profilePS5007112.503130193IPR001356Homeobox domain
SMARTSM003898.0E-12132197IPR001356Homeobox domain
SuperFamilySSF466895.56E-19132200IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-26135196IPR009057Homeodomain-like
CDDcd000868.07E-13146194No hitNo description
PfamPF059208.2E-17150189IPR008422Homeobox KN domain
PROSITE patternPS000270168191IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
XKDQIANHPL YSNLLSAYIQ CRKVGAPPEM ASLLEDISKG NHHISSCTEI GADPELDXIQ  60
LCKETLPPLT TNYCLDGRSC HSDEMDIGGG DVEATHSQVV SYNREGDHHH LKEMLMKKYG  120
GYLSGLKSDF LKKRKKGKLP KGARTTLLQW WNTHYRWPYP TEEEKNVLAE VTGLDQRQIN  180
NWFINQRKRH WKPSQDMRFA LNMEGVNDGV NEGID
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125134LKSDFLKKRK
2131135KKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087493.16e-88PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-60KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A0E3TKF58e-89A0A0E3TKF5_9ERIC; Knotted-like 6 protein
STRINGPOPTR_0005s01720.14e-74(Populus trichocarpa)
STRINGSolyc01g100510.2.15e-74(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480